PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004493942.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family NF-YB
Protein Properties Length: 171aa    MW: 18756.9 Da    PI: 6.5189
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004493942.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.71.6e-5825121298
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     reqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl++yre+eg+
  XP_004493942.1  25 REQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLTRYREMEGD 119
                     89********************************************************************************************9 PP

           NF-YB  97 kk 98 
                     +k
  XP_004493942.1 120 TK 121
                     75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.9E-5521134IPR009072Histone-fold
SuperFamilySSF471133.11E-4127130IPR009072Histone-fold
PfamPF008083.3E-283094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-205876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.4E-207795No hitNo description
PRINTSPR006151.4E-2096114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MSEGPASPGG GSHESGEHSP RSNIREQDRY LPIANISRIM KKALPANGKI AKDAKETVQE  60
CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMATLGFE DYIDPLKIYL TRYREMEGDT  120
KGSAKGGDTS AKKDVQQGSN PQLAHQGSFS QSVSYTNSQG QHMMVPMQGP E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-4823115193NF-YB
4awl_B2e-4823115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4823115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4g91_B2e-4824115192Transcription factor HapC (Eurofung)
4g92_B2e-4824115192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182750.0JQ918275.1 Medicago truncatula nuclear transcription factor Y subunit B2 (NF-YB2) mRNA, complete cds.
GenBankKJ0000830.0KJ000083.1 Medicago sativa nuclear factor Y subunit B isoform 3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004493942.11e-127PREDICTED: nuclear transcription factor Y subunit B-10
SwissprotQ8VYK41e-87NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0H3UW931e-123A0A0H3UW93_MEDSA; Nuclear factor Y subunit B isoform 3
TrEMBLG7L1Q21e-123G7L1Q2_MEDTR; Nuclear transcription factor Y subunit B
STRINGGLYMA03G33490.11e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.17e-84nuclear factor Y, subunit B10